Lineage for d6tvrc1 (6tvr C:2-320)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776288Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries)
  8. 2776314Domain d6tvrc1: 6tvr C:2-320 [392219]
    Other proteins in same PDB: d6tvra2, d6tvrb_, d6tvrc2, d6tvrd_, d6tvre2, d6tvrf_, d6tvrg2, d6tvrh_, d6tvri2, d6tvrj_, d6tvrk2, d6tvrl_
    automated match to d3ztna_
    complexed with ca, edo, nag; mutant

Details for d6tvrc1

PDB Entry: 6tvr (more details), 2.63 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu) from an h10n7 seal influenza virus isolated in germany
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d6tvrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvrc1 b.19.1.0 (C:2-320) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
pdkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigm
ligtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygs
sinsagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhps
stqekndlygtqslsisvgsstyknnfvpvvgarpqvnglsgridfhwtlvqpgdkitfs
hnggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcp
kyvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d6tvrc1:

Click to download the PDB-style file with coordinates for d6tvrc1.
(The format of our PDB-style files is described here.)

Timeline for d6tvrc1: