Lineage for d6tvsl_ (6tvs L:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040861Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [419795] (10 PDB entries)
  8. 3040864Domain d6tvsl_: 6tvs L: [392213]
    Other proteins in same PDB: d6tvsc1, d6tvsc2, d6tvse1, d6tvse2, d6tvsk1, d6tvsk2
    automated match to d4d00d_
    complexed with ca, edo, nag; mutant

Details for d6tvsl_

PDB Entry: 6tvs (more details), 1.9 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu) from an h10n7 seal influenza virus isolated in germany in complex with avian receptor analogue 3'-sln
PDB Compounds: (L:) hemagglutinin HA2

SCOPe Domain Sequences for d6tvsl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvsl_ h.3.1.1 (L:) Influenza hemagglutinin (stalk) {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d6tvsl_:

Click to download the PDB-style file with coordinates for d6tvsl_.
(The format of our PDB-style files is described here.)

Timeline for d6tvsl_: