Lineage for d1ft8e_ (1ft8 E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1416085Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 1416086Protein mRNA export factor tap [54955] (1 species)
  7. 1416087Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
  8. 1416095Domain d1ft8e_: 1ft8 E: [39216]
    Other proteins in same PDB: d1ft8a1, d1ft8b_, d1ft8c1, d1ft8d_

Details for d1ft8e_

PDB Entry: 1ft8 (more details), 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap
PDB Compounds: (E:) tip associating protein

SCOPe Domain Sequences for d1ft8e_:

Sequence, based on SEQRES records: (download)

>d1ft8e_ d.58.7.2 (E:) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
wfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkav

Sequence, based on observed residues (ATOM records): (download)

>d1ft8e_ d.58.7.2 (E:) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
wfkitdkawllsmiqskcsvpftpiefhqffvedastasalkav

SCOPe Domain Coordinates for d1ft8e_:

Click to download the PDB-style file with coordinates for d1ft8e_.
(The format of our PDB-style files is described here.)

Timeline for d1ft8e_: