Lineage for d6tvcd_ (6tvc D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041052Domain d6tvcd_: 6tvc D: [392150]
    Other proteins in same PDB: d6tvca1, d6tvca2, d6tvcc1, d6tvcc2, d6tvce1, d6tvce2
    automated match to d4cyvb_
    complexed with nag

Details for d6tvcd_

PDB Entry: 6tvc (more details), 1.84 Å

PDB Description: crystal structure of the haemagglutinin from a transmissible h10n7 seal influenza virus isolated in netherland
PDB Compounds: (D:) haemagglutinin ha2

SCOPe Domain Sequences for d6tvcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvcd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntynhsqyreeallnrln

SCOPe Domain Coordinates for d6tvcd_:

Click to download the PDB-style file with coordinates for d6tvcd_.
(The format of our PDB-style files is described here.)

Timeline for d6tvcd_: