Lineage for d1fjeb2 (1fje B:92-175)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. 32667Protein Nucleolin [54952] (1 species)
  7. 32668Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54953] (3 PDB entries)
  8. 32671Domain d1fjeb2: 1fje B:92-175 [39211]

Details for d1fjeb2

PDB Entry: 1fje (more details)

PDB Description: solution structure of nucleolin rbd12 in complex with snre rna

SCOP Domain Sequences for d1fjeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjeb2 d.58.7.1 (B:92-175) Nucleolin {Golden hamster (Mesocricetus auratus)}
dskkvraartllaknlsfnitedelkevfedaleirlvsqdgkskgiayiefkseadaek
nleekqgaeidgrsvslyytgekg

SCOP Domain Coordinates for d1fjeb2:

Click to download the PDB-style file with coordinates for d1fjeb2.
(The format of our PDB-style files is described here.)

Timeline for d1fjeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fjeb1