Lineage for d6tvdh_ (6tvd H:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041257Domain d6tvdh_: 6tvd H: [392079]
    Other proteins in same PDB: d6tvda1, d6tvda2, d6tvdc_, d6tvde_, d6tvdg1, d6tvdg2, d6tvdi_, d6tvdk_
    automated match to d4d00d_
    complexed with ca, nag

Details for d6tvdh_

PDB Entry: 6tvd (more details), 2.7 Å

PDB Description: crystal structure of the haemagglutinin from a h10n7 seal influenza virus isolated in germany in complex with avian receptor analogue, 3'-sln
PDB Compounds: (H:) hemagglutinin HA2

SCOPe Domain Sequences for d6tvdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvdh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnriikktn
tefesiesefseidhqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d6tvdh_:

Click to download the PDB-style file with coordinates for d6tvdh_.
(The format of our PDB-style files is described here.)

Timeline for d6tvdh_: