Lineage for d1cvjh1 (1cvj H:11-90)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952047Protein Poly(A)-binding protein [54948] (1 species)
  7. 2952048Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
  8. 2952063Domain d1cvjh1: 1cvj H:11-90 [39205]
    protein/RNA complex; complexed with a

Details for d1cvjh1

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna
PDB Compounds: (H:) polyadenylate binding protein 1

SCOPe Domain Sequences for d1cvjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvjh1 d.58.7.1 (H:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}
aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
tmnfdvikgkpvrimwsqrd

SCOPe Domain Coordinates for d1cvjh1:

Click to download the PDB-style file with coordinates for d1cvjh1.
(The format of our PDB-style files is described here.)

Timeline for d1cvjh1: