| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Bacterial alpha-Amylase [51013] (9 species) |
| Species Bacillus licheniformis [TaxId:1402] [51014] (13 PDB entries) |
| Domain d6toya2: 6toy A:394-483 [392016] Other proteins in same PDB: d6toya1 automated match to d1hvxa1 complexed with acy, ca, fmt, mli, na |
PDB Entry: 6toy (more details), 1.95 Å
SCOPe Domain Sequences for d6toya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6toya2 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus licheniformis [TaxId: 1402]}
yaygaqhdyfdhhnivgwtregdssvansglaalitdgpggtkrmyvgrqnagetwhdit
gnrsdsvvinaegwgefhvnggsvsiyvqr
Timeline for d6toya2: