Lineage for d6toya1 (6toy A:3-393)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Bacterial alpha-amylase [51447] (10 species) 
Species Bacillus licheniformis [TaxId:1402] [51448] (9 PDB entries) 
Domain d6toya1: 6toy A:3-393 [392015]
Other proteins in same PDB: d6toya2
automated match to d1hvxa2
complexed with acy, ca, fmt, mli, na
Details for d6toya1
PDB Entry: 6toy (more details), 1.95 Å
PDB Description: crystal structure of bacillus paralicheniformis wild-type alpha- amylase
PDB Compounds: (A:) amylaseSCOPe Domain Sequences for d6toya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6toya1 c.1.8.1 (A:3-393) Bacterial alpha-amylase {Bacillus licheniformis [TaxId: 1402]}
lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqddvgygaydly
dlgefhqkgtvrtkygtkgelqsainslhsrdinvygdvvinhkggadateyvtavevdp
adrnrvtsgeqrikawthfqfpgrgstysdfkwywyhfdgtdwdesrklnriykfqgkaw
dwevsnengnydylmyadidydhpdvtaeikrwgtwyanelqldgfrldavkhikfsflr
dwvnhvrektgkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggy
dmrkllngtvvskhpvkavtfvdnhdtqpgqslestvqtwfkplayafiltreagypqif
ygdmygtkgasqreipalkhkiepilkarkq
SCOPe Domain Coordinates for d6toya1:
Click to download the PDB-style file with coordinates for d6toya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6toya1:
- d6toya1 first appeared in SCOPe 2.07
View in 3D
