Lineage for d6tl9e1 (6tl9 E:143-270)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002597Domain d6tl9e1: 6tl9 E:143-270 [392011]
    Other proteins in same PDB: d6tl9a2, d6tl9b2, d6tl9c2, d6tl9d2, d6tl9e2, d6tl9f2, d6tl9g2, d6tl9h2
    automated match to d1ypob_
    complexed with gol, njt

Details for d6tl9e1

PDB Entry: 6tl9 (more details), 2.73 Å

PDB Description: crystal structure of lectin-like ox-ldl receptor 1 in complex with bi- 0115
PDB Compounds: (E:) Oxidized low-density lipoprotein receptor 1

SCOPe Domain Sequences for d6tl9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tl9e1 d.169.1.0 (E:143-270) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfpf
wmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaafs
icqkkanl

SCOPe Domain Coordinates for d6tl9e1:

Click to download the PDB-style file with coordinates for d6tl9e1.
(The format of our PDB-style files is described here.)

Timeline for d6tl9e1: