Lineage for d6tp1a1 (6tp1 A:3-393)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829944Protein Bacterial alpha-amylase [51447] (10 species)
  7. 2829947Species Bacillus licheniformis [TaxId:1402] [51448] (9 PDB entries)
  8. 2829951Domain d6tp1a1: 6tp1 A:3-393 [392007]
    Other proteins in same PDB: d6tp1a2
    automated match to d1hvxa2
    complexed with acy, ca, glc, mli, na

Details for d6tp1a1

PDB Entry: 6tp1 (more details), 1.94 Å

PDB Description: crystal structure of bacillus paralicheniformis alpha-amylase in complex with maltotetraose
PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d6tp1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tp1a1 c.1.8.1 (A:3-393) Bacterial alpha-amylase {Bacillus licheniformis [TaxId: 1402]}
lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqddvgygaydly
dlgefhqkgtvrtkygtkgelqsainslhsrdinvygdvvinhkggadateyvtavevdp
adrnrvtsgeqrikawthfqfpgrgstysdfkwywyhfdgtdwdesrklnriykfqgkaw
dwevsnengnydylmyadidydhpdvtaeikrwgtwyanelqldgfrldavkhikfsflr
dwvnhvrektgkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggy
dmrkllngtvvskhpvkavtfvdnhdtqpgqslestvqtwfkplayafiltreagypqif
ygdmygtkgasqreipalkhkiepilkarkq

SCOPe Domain Coordinates for d6tp1a1:

Click to download the PDB-style file with coordinates for d6tp1a1.
(The format of our PDB-style files is described here.)

Timeline for d6tp1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6tp1a2