SCOPe 2.08: Domain d6tl9b1: 6tl9 B:143-269

Lineage for d6tl9b1 (6tl9 B:143-269)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d6tl9b1: 6tl9 B:143-269 [391999]
   Other proteins in same PDB: d6tl9a2, d6tl9b2, d6tl9c2, d6tl9d2, d6tl9e2, d6tl9f2, d6tl9g2, d6tl9h2
   automated match to d1ypob_
   complexed with gol, njt

Details for d6tl9b1

PDB Entry: 6tl9, 2.73 Å

PDB Description: crystal structure of lectin-like ox-ldl receptor 1 in complex with bi- 0115

PDB Compounds: (B:) Oxidized low-density lipoprotein receptor 1

SCOPe Domain Sequences for d6tl9b1:

Sequence; same for both SEQRES and ATOM records:

>d6tl9b1 d.169.1.0 (B:143-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfpf
wmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaafs
icqkkan

Timeline for d6tl9b1:

• d6tl9b1 first appeared in SCOPe 2.07