Lineage for d1cvjd2 (1cvj D:91-175)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504527Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 504528Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 504606Protein Poly(A)-binding protein [54948] (1 species)
  7. 504607Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
  8. 504615Domain d1cvjd2: 1cvj D:91-175 [39198]

Details for d1cvjd2

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

SCOP Domain Sequences for d1cvjd2:

Sequence, based on SEQRES records: (download)

>d1cvjd2 d.58.7.1 (D:91-175) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqea
aeraiekmngmllndrkvfvgrfks

Sequence, based on observed residues (ATOM records): (download)

>d1cvjd2 d.58.7.1 (D:91-175) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcskgygfvhfetqeaaera
iekmngmllndrkvfvgrfks

SCOP Domain Coordinates for d1cvjd2:

Click to download the PDB-style file with coordinates for d1cvjd2.
(The format of our PDB-style files is described here.)

Timeline for d1cvjd2: