Class a: All alpha proteins [46456] (290 folds) |
Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.1: STAT [47655] (2 families) |
Family a.47.1.0: automated matches [391954] (1 protein) not a true family |
Protein automated matches [391955] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [391956] (1 PDB entry) |
Domain d6tlca1: 6tlc A:136-321 [391966] Other proteins in same PDB: d6tlca2, d6tlca3, d6tlcb2, d6tlcb3, d6tlcc_, d6tlcd_ automated match to d1bg1a1 |
PDB Entry: 6tlc (more details), 2.9 Å
SCOPe Domain Sequences for d6tlca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tlca1 a.47.1.0 (A:136-321) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgdmqdlngnnqsv trqkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwkrrqqiaciggp pnicldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpmleerivelfrn lmksaf
Timeline for d6tlca1: