Lineage for d6tlcb1 (6tlc B:136-321)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714459Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2714460Superfamily a.47.1: STAT [47655] (2 families) (S)
  5. 2714472Family a.47.1.0: automated matches [391954] (1 protein)
    not a true family
  6. 2714473Protein automated matches [391955] (1 species)
    not a true protein
  7. 2714474Species Human (Homo sapiens) [TaxId:9606] [391956] (1 PDB entry)
  8. 2714476Domain d6tlcb1: 6tlc B:136-321 [391957]
    Other proteins in same PDB: d6tlca2, d6tlca3, d6tlcb2, d6tlcb3, d6tlcc_, d6tlcd_
    automated match to d1bg1a1

Details for d6tlcb1

PDB Entry: 6tlc (more details), 2.9 Å

PDB Description: unphosphorylated human stat3 in complex with ms3-6 monobody
PDB Compounds: (B:) Signal transducer and activator of transcription 3

SCOPe Domain Sequences for d6tlcb1:

Sequence, based on SEQRES records: (download)

>d6tlcb1 a.47.1.0 (B:136-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgdmqdlngnnqsv
trqkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwkrrqqiaciggp
pnicldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpmleerivelfrn
lmksaf

Sequence, based on observed residues (ATOM records): (download)

>d6tlcb1 a.47.1.0 (B:136-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgdmqdlnnqsvtr
qkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwkrrqqiaciggppn
icldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpmleerivelfrnlm
ksaf

SCOPe Domain Coordinates for d6tlcb1:

Click to download the PDB-style file with coordinates for d6tlcb1.
(The format of our PDB-style files is described here.)

Timeline for d6tlcb1: