Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) |
Domain d6tlcd_: 6tlc D: [391953] Other proteins in same PDB: d6tlca1, d6tlca2, d6tlca3, d6tlcb1, d6tlcb2, d6tlcb3 automated match to d3uyod_ |
PDB Entry: 6tlc (more details), 2.9 Å
SCOPe Domain Sequences for d6tlcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tlcd_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsvssvptklevvaatptslliswdapavtvdfyhitygetggnspvqeftvpgskstat isglkpgvdytitvyayvsypeyyfpspisinyrt
Timeline for d6tlcd_: