Lineage for d1cvjb2 (1cvj B:91-175)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80286Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 80287Family d.58.7.1: Canonical RBD [54929] (13 proteins)
  6. 80325Protein Poly(A)-binding protein [54948] (1 species)
  7. 80326Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
  8. 80330Domain d1cvjb2: 1cvj B:91-175 [39194]

Details for d1cvjb2

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

SCOP Domain Sequences for d1cvjb2:

Sequence, based on SEQRES records: (download)

>d1cvjb2 d.58.7.1 (B:91-175) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqea
aeraiekmngmllndrkvfvgrfks

Sequence, based on observed residues (ATOM records): (download)

>d1cvjb2 d.58.7.1 (B:91-175) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcskgygfvhfetqeaaera
iekmnvgrfks

SCOP Domain Coordinates for d1cvjb2:

Click to download the PDB-style file with coordinates for d1cvjb2.
(The format of our PDB-style files is described here.)

Timeline for d1cvjb2: