Lineage for d2msta_ (2mst A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (13 proteins) 
Protein Neural RNA-binding protein Musashi-1 [54946] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [54947] (2 PDB entries) 
Domain d2msta_: 2mst A: [39189]
Details for d2msta_
PDB Entry: 2mst (more details)
PDB Description: musashi1 rbd2, nmr
SCOP Domain Sequences for d2msta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus)}
kifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvcei
hfheinnkmveckka
SCOP Domain Coordinates for d2msta_:
Click to download the PDB-style file with coordinates for d2msta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2msta_:
- d2msta_ first appeared (with stable ids) in SCOP 1.55
- d2msta_ appears in SCOP 1.57
- d2msta_ appears in SCOP 1.61
- d2msta_ appears in the current release, SCOPe 2.08
View in 3D