Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
Domain d6tdea2: 6tde A:246-440 [391888] Other proteins in same PDB: d6tdea1, d6tdeb1, d6tdec1, d6tded1, d6tdee1, d6tdee2 automated match to d4i50a2 complexed with gdp, gtp, mg, n3z, so4 |
PDB Entry: 6tde (more details), 2.29 Å
SCOPe Domain Sequences for d6tdea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tdea2 d.79.2.1 (A:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d6tdea2: