SCOPe 2.08: Domain d6tdea2: 6tde A:246-440

Lineage for d6tdea2 (6tde A:246-440)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
Domain d6tdea2: 6tde A:246-440 [391888]
Other proteins in same PDB: d6tdea1, d6tdeb1, d6tdec1, d6tded1, d6tdee1, d6tdee2
automated match to d4i50a2
complexed with gdp, gtp, mg, n3z, so4

Details for d6tdea2

PDB Entry: 6tde (more details), 2.29 Å

PDB Description: tubulin-inhibitor complex

PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d6tdea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tdea2 d.79.2.1 (A:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d6tdea2:

Click to download the PDB-style file with coordinates for d6tdea2.
(The format of our PDB-style files is described here.)

Timeline for d6tdea2: