Lineage for d1hd1a_ (1hd1 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257431Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 257432Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 257444Protein Heterogeneous nuclear ribonucleoprotein d0 [54944] (1 species)
  7. 257445Species Human (Homo sapiens) [TaxId:9606] [54945] (2 PDB entries)
  8. 257446Domain d1hd1a_: 1hd1 A: [39187]
    RBD1

Details for d1hd1a_

PDB Entry: 1hd1 (more details)

PDB Description: heterogeneous nuclear ribonucleoprotein d0 (hnrnp d0 rbd1), nmr

SCOP Domain Sequences for d1hd1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hd1a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens)}
kmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkvmdq
kehklngkvidpkra

SCOP Domain Coordinates for d1hd1a_:

Click to download the PDB-style file with coordinates for d1hd1a_.
(The format of our PDB-style files is described here.)

Timeline for d1hd1a_: