Lineage for d1fxla1 (1fxl A:37-118)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908512Protein Hu antigen D (Hud) [54942] (1 species)
  7. 1908513Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries)
  8. 1908514Domain d1fxla1: 1fxl A:37-118 [39183]
    protein/RNA complex

Details for d1fxla1

PDB Entry: 1fxl (more details), 1.8 Å

PDB Description: crystal structure of hud and au-rich element of the c-fos rna
PDB Compounds: (A:) paraneoplastic encephalomyelitis antigen hud

SCOPe Domain Sequences for d1fxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}
sktnlivnylpqnmtqeefrslfgsigeiescklvrdkitgqslgygfvnyidpkdaeka
intlnglrlqtktikvsyarps

SCOPe Domain Coordinates for d1fxla1:

Click to download the PDB-style file with coordinates for d1fxla1.
(The format of our PDB-style files is described here.)

Timeline for d1fxla1: