Lineage for d1d9aa_ (1d9a A:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (14 proteins) 
Protein Hu antigen C (Huc) [54940] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [54941] (2 PDB entries) 
Domain d1d9aa_: 1d9a A: [39182]
the second RNA-binding domain (RBD2)
Details for d1d9aa_
PDB Entry: 1d9a (more details)
PDB Description: solution structure of the second rna-binding domain (rbd2) of hu antigen c (huc)
SCOP Domain Sequences for d1d9aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9aa_ d.58.7.1 (A:) Hu antigen C (Huc) {Mouse (Mus musculus)}
danlyvsglpktmsqkemeqlfsqygriitsrilldqatgvsrgvgfirfdkrieaeeai
kglngqkplgaaepitvkfannpsq
SCOP Domain Coordinates for d1d9aa_:
Click to download the PDB-style file with coordinates for d1d9aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d9aa_:
- d1d9aa_ first appeared (with stable ids) in SCOP 1.55
- d1d9aa_ appears in SCOP 1.61
- d1d9aa_ appears in SCOP 1.65
- d1d9aa_ appears in the current release, SCOPe 2.08
View in 3D