Lineage for d1d8za_ (1d8z A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192276Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 192277Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 192287Protein Hu antigen C (Huc) [54940] (1 species)
  7. 192288Species Mouse (Mus musculus) [TaxId:10090] [54941] (2 PDB entries)
  8. 192289Domain d1d8za_: 1d8z A: [39181]

Details for d1d8za_

PDB Entry: 1d8z (more details)

PDB Description: solution structure of the first rna-binding domain (rbd1) of hu antigen c (huc)

SCOP Domain Sequences for d1d8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8za_ d.58.7.1 (A:) Hu antigen C (Huc) {Mouse (Mus musculus)}
mdsktnlivnylpqnmtqdefkslfgsigdiescklvrdkitgqslgygfvnysdpndad
kaintlnglklqtktikvsyarpssasir

SCOP Domain Coordinates for d1d8za_:

Click to download the PDB-style file with coordinates for d1d8za_.
(The format of our PDB-style files is described here.)

Timeline for d1d8za_: