Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Escherichia coli [TaxId:562] [187725] (8 PDB entries) |
Domain d6sm7d1: 6sm7 D:2-163 [391759] Other proteins in same PDB: d6sm7a2, d6sm7b2, d6sm7c2, d6sm7d2 automated match to d3pdua1 complexed with bo3 |
PDB Entry: 6sm7 (more details), 1.88 Å
SCOPe Domain Sequences for d6sm7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sm7d1 c.2.1.0 (D:2-163) automated matches {Escherichia coli [TaxId: 562]} aaiafiglgqmgspmasnllqqghqlrvfdvnaeavrhlvdkgatpaanpaqaakdaefi itmlpngdlvrnvlfgengvceglstdalvidmstihplqtdkliadmqakgfsmmdvpv grtsanaitgtllllaggtaeqveratpilmamgselinagg
Timeline for d6sm7d1: