Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.1: Canonical RBD [54929] (14 proteins) |
Protein Sex-lethal protein [54938] (1 species) |
Species Drosophila melanogaster [TaxId:7227] [54939] (4 PDB entries) |
Domain d3sxla1: 3sxl A:124-203 [39173] |
PDB Entry: 3sxl (more details), 2.7 Å
SCOP Domain Sequences for d3sxla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sxla1 d.58.7.1 (A:124-203) Sex-lethal protein {Drosophila melanogaster} ntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysfgyafvdftsemdsqrai kvlngitvrnkrlkvsyarp
Timeline for d3sxla1:
View in 3D Domains from other chains: (mouse over for more information) d3sxlb1, d3sxlb2, d3sxlc1, d3sxlc2 |