Lineage for d1a9nd_ (1a9n D:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192276Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 192277Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 192376Protein Splicing factor U2B'' [54934] (1 species)
  7. 192377Species Human (Homo sapiens) [TaxId:9606] [54935] (1 PDB entry)
  8. 192379Domain d1a9nd_: 1a9n D: [39166]
    Other proteins in same PDB: d1a9na_, d1a9nc_

Details for d1a9nd_

PDB Entry: 1a9n (more details), 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna

SCOP Domain Sequences for d1a9nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9nd_ d.58.7.1 (D:) Splicing factor U2B'' {Human (Homo sapiens)}
irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
tnalrqlqgfpfygkpmriqyaktdsdiiskmr

SCOP Domain Coordinates for d1a9nd_:

Click to download the PDB-style file with coordinates for d1a9nd_.
(The format of our PDB-style files is described here.)

Timeline for d1a9nd_: