![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (12 proteins) |
![]() | Protein Splicing factor U2B'' [54934] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54935] (1 PDB entry) |
![]() | Domain d1a9nd_: 1a9n D: [39166] Other proteins in same PDB: d1a9na_, d1a9nc_ |
PDB Entry: 1a9n (more details), 2.38 Å
SCOP Domain Sequences for d1a9nd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9nd_ d.58.7.1 (D:) Splicing factor U2B'' {Human (Homo sapiens)} irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss tnalrqlqgfpfygkpmriqyaktdsdiiskmr
Timeline for d1a9nd_: