![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Spliceosomal U2 small nuclear ribonucleoprotein B" / U2B" / Msl1 protein [54934] (2 species) 3jb9 chain k is Msl1 from fission yeast; not included because sids are not case sensitive |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54935] (1 PDB entry) |
![]() | Domain d1a9nd_: 1a9n D: [39166] Other proteins in same PDB: d1a9na_, d1a9nc_ protein/RNA complex |
PDB Entry: 1a9n (more details), 2.38 Å
SCOPe Domain Sequences for d1a9nd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9nd_ d.58.7.1 (D:) Spliceosomal U2 small nuclear ribonucleoprotein B" / U2B" / Msl1 protein {Human (Homo sapiens) [TaxId: 9606]} irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss tnalrqlqgfpfygkpmriqyaktdsdiiskmr
Timeline for d1a9nd_: