Lineage for d2u1a__ (2u1a -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80286Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 80287Family d.58.7.1: Canonical RBD [54929] (13 proteins)
  6. 80361Protein Splicesomal U1A protein [54932] (1 species)
  7. 80362Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries)
  8. 80373Domain d2u1a__: 2u1a - [39164]

Details for d2u1a__

PDB Entry: 2u1a (more details)

PDB Description: rna binding domain 2 of human u1a protein, nmr, 20 structures

SCOP Domain Sequences for d2u1a__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2u1a__ d.58.7.1 (-) Splicesomal U1A protein {Human (Homo sapiens)}
mapaqplsenppnhilfltnlpeetnelmlsmlfnqfpgfkevrlvpgrhdiafvefdne
vqagaardalqgfkitqnnamkisfakk

SCOP Domain Coordinates for d2u1a__:

Click to download the PDB-style file with coordinates for d2u1a__.
(The format of our PDB-style files is described here.)

Timeline for d2u1a__: