Lineage for d1dz5b_ (1dz5 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133613Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 133614Family d.58.7.1: Canonical RBD [54929] (13 proteins)
  6. 133688Protein Splicesomal U1A protein [54932] (1 species)
  7. 133689Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries)
  8. 133699Domain d1dz5b_: 1dz5 B: [39163]

Details for d1dz5b_

PDB Entry: 1dz5 (more details)

PDB Description: The NMR structure of the 38KDa U1A protein-PIE RNA complex reveals the basis of cooperativity in regulation of polyadenylation by human U1A protein

SCOP Domain Sequences for d1dz5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dz5b_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)}
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv

SCOP Domain Coordinates for d1dz5b_:

Click to download the PDB-style file with coordinates for d1dz5b_.
(The format of our PDB-style files is described here.)

Timeline for d1dz5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dz5a_