Lineage for d1nrcb_ (1nrc B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257431Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 257432Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 257517Protein Splicesomal U1A protein [54932] (1 species)
    duplication: contains two domains of this fold
  7. 257518Species Human (Homo sapiens) [TaxId:9606] [54933] (13 PDB entries)
  8. 257540Domain d1nrcb_: 1nrc B: [39161]
    CA-atoms only, mutant protein sequence, domain 1

Details for d1nrcb_

PDB Entry: 1nrc (more details), 2.8 Å

PDB Description: crystal structure of the rna-binding domain of the u1 small nuclear ribonucleoprotein a

SCOP Domain Sequences for d1nrcb_:

Sequence, based on SEQRES records: (download)

>d1nrcb_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmricyak

Sequence, based on observed residues (ATOM records): (download)

>d1nrcb_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslgqafvifkevssatna
lrsmqgfpfydkpmricyak

SCOP Domain Coordinates for d1nrcb_:

Click to download the PDB-style file with coordinates for d1nrcb_.
(The format of our PDB-style files is described here.)

Timeline for d1nrcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nrca_