Lineage for d1nrcb_ (1nrc B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133613Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 133614Family d.58.7.1: Canonical RBD [54929] (13 proteins)
  6. 133688Protein Splicesomal U1A protein [54932] (1 species)
  7. 133689Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries)
  8. 133703Domain d1nrcb_: 1nrc B: [39161]

Details for d1nrcb_

PDB Entry: 1nrc (more details), 2.8 Å

PDB Description: crystal structure of the rna-binding domain of the u1 small nuclear ribonucleoprotein a

SCOP Domain Sequences for d1nrcb_:

Sequence, based on SEQRES records: (download)

>d1nrcb_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmricyak

Sequence, based on observed residues (ATOM records): (download)

>d1nrcb_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslgqafvifkevssatna
lrsmqgfpfydkpmricyak

SCOP Domain Coordinates for d1nrcb_:

Click to download the PDB-style file with coordinates for d1nrcb_.
(The format of our PDB-style files is described here.)

Timeline for d1nrcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nrca_