Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:269796] [335612] (2 PDB entries) |
Domain d6suwf_: 6suw F: [391601] Other proteins in same PDB: d6suwa2, d6suwk2, d6suwl2, d6suws2 automated match to d1zpyg_ complexed with ca, fe |
PDB Entry: 6suw (more details), 2.66 Å
SCOPe Domain Sequences for d6suwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6suwf_ a.25.1.0 (F:) automated matches {Rhodospirillum rubrum [TaxId: 269796]} stheplevlkeetvnrhraivsvmaeleavdwydqrvdastdpeltailahnrdeekeha amtlewlrrndakwaehlrtylftegpita
Timeline for d6suwf_:
View in 3D Domains from other chains: (mouse over for more information) d6suwa1, d6suwa2, d6suwb_, d6suwc_, d6suwd_, d6suwe_, d6suwg_, d6suwh_, d6suwi_, d6suwj_, d6suwk1, d6suwk2, d6suwl1, d6suwl2, d6suwm_, d6suwn_, d6suwo_, d6suwp_, d6suwq_, d6suwr_, d6suws1, d6suws2, d6suwt_, d6suwu_, d6suwv_, d6suww_, d6suwx_, d6suwy_, d6suwz_ |