Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.1: Bromodomain [47371] (6 proteins) |
Protein automated matches [190366] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries) |
Domain d6sqmc_: 6sqm C: [391584] automated match to d4nyxa_ complexed with edo, lu5 |
PDB Entry: 6sqm (more details), 1.8 Å
SCOPe Domain Sequences for d6sqmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sqmc_ a.29.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
Timeline for d6sqmc_: