Lineage for d1auda_ (1aud A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (14 proteins) 
Protein Splicesomal U1A protein [54932] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries) 
Domain d1auda_: 1aud A: [39156]
Details for d1auda_
PDB Entry: 1aud (more details)
PDB Description: u1a-utrrna, nmr, 31 structures
SCOP Domain Sequences for d1auda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auda_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)}
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv
SCOP Domain Coordinates for d1auda_:
Click to download the PDB-style file with coordinates for d1auda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1auda_:
- d1auda_ first appeared (with stable ids) in SCOP 1.55
- d1auda_ appears in SCOP 1.59
- d1auda_ appears in SCOP 1.63
- d1auda_ appears in the current release, SCOPe 2.08
View in 3D