Lineage for d1auda_ (1aud A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. Protein Splicesomal U1A protein [54932] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54933] (8 PDB entries)
  8. 32718Domain d1auda_: 1aud A: [39156]

Details for d1auda_

PDB Entry: 1aud (more details)

PDB Description: u1a-utrrna, nmr, 31 structures

SCOP Domain Sequences for d1auda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auda_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)}
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv

SCOP Domain Coordinates for d1auda_:

Click to download the PDB-style file with coordinates for d1auda_.
(The format of our PDB-style files is described here.)

Timeline for d1auda_: