Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.1: Canonical RBD [54929] (13 proteins) |
Protein Splicesomal U1A protein [54932] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries) |
Domain d1urnb_: 1urn B: [39154] |
PDB Entry: 1urn (more details), 1.92 Å
SCOP Domain Sequences for d1urnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urnb_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)} avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
Timeline for d1urnb_: