Lineage for d1urnb_ (1urn B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133613Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 133614Family d.58.7.1: Canonical RBD [54929] (13 proteins)
  6. 133688Protein Splicesomal U1A protein [54932] (1 species)
  7. 133689Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries)
  8. 133691Domain d1urnb_: 1urn B: [39154]

Details for d1urnb_

PDB Entry: 1urn (more details), 1.92 Å

PDB Description: u1a mutant/rna complex + glycerol

SCOP Domain Sequences for d1urnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urnb_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)}
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakm

SCOP Domain Coordinates for d1urnb_:

Click to download the PDB-style file with coordinates for d1urnb_.
(The format of our PDB-style files is described here.)

Timeline for d1urnb_: