Lineage for d1urnb_ (1urn B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. Protein Splicesomal U1A protein [54932] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54933] (8 PDB entries)
  8. Domain d1urnb_: 1urn B: [39154]

Details for d1urnb_

PDB Entry: 1urn (more details), 1.92 Å

PDB Description: u1a mutant/rna complex + glycerol

SCOP Domain Sequences for d1urnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urnb_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens)}
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakm

SCOP Domain Coordinates for d1urnb_ are not available.

Timeline for d1urnb_:

Domains from other chains:
(mouse over for more information)
d1urna_, d1urnc_