Lineage for d1ha1_2 (1ha1 99-180)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (14 proteins) Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54931] (4 PDB entries) 
Domain d1ha1_2: 1ha1 99-180 [39148]
Details for d1ha1_2
PDB Entry: 1ha1 (more details), 1.75 Å
PDB Description: hnrnp a1 (rbd1,2) from homo sapiens
SCOP Domain Sequences for d1ha1_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha1_2 d.58.7.1 (99-180) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens)}
ahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsv
dkiviqkyhtvnghncevrkal
SCOP Domain Coordinates for d1ha1_2:
Click to download the PDB-style file with coordinates for d1ha1_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ha1_2:
- d1ha1_2 first appeared (with stable ids) in SCOP 1.55
- d1ha1_2 appears in SCOP 1.59
- d1ha1_2 appears in SCOP 1.63
- d1ha1_2 appears in the current release, SCOPe 2.08, called d1ha1a2
View in 3D
