SCOPe 2.08: Domain d6s95a_: 6s95 A:

Lineage for d6s95a_ (6s95 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (10 species)
   not a true protein

7. Species Usutu virus [TaxId:64286] [391462] (4 PDB entries)

8. Domain d6s95a_: 6s95 A: [391478]
   automated match to d1pjwa_

Details for d6s95a_

PDB Entry: 6s95, 1.19 Å

PDB Description: crystal structure of group i of usutu virus envelope protein domain iii

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d6s95a_:

Sequence; same for both SEQRES and ATOM records:

>d6s95a_ b.1.18.4 (A:) automated matches {Usutu virus [TaxId: 64286]}
gttygmctkkfsfaknpadtghgtvvlelqytgvdgpckipisivaslsdltpigrmvta
npyvasseanskvlvemeppfgdsfivvgrgdkqinhhwhka

Timeline for d6s95a_:

• d6s95a_ first appeared in SCOPe 2.07