Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (25 species) not a true protein |
Species Aequorea australis [TaxId:1246302] [391430] (2 PDB entries) |
Domain d6s68b_: 6s68 B: [391431] automated match to d2hpwa_ complexed with pia |
PDB Entry: 6s68 (more details), 2.06 Å
SCOPe Domain Sequences for d6s68b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s68b_ d.22.1.0 (B:) automated matches {Aequorea australis [TaxId: 1246302]} lfkgkipfvvelegdvngevfsvrgngwgdgstgkleikfvcttgevplaweslicsmxa lvfckypsnindffkstmprgyiqerkisyendgtfdvrqevtyengalynrvkfngsgf rkdgnvlgkkldltsigtciyimgndegtglkgvfnkafkviggnrqiashvqtqtpigd glvsipdyhvmhnhiacskdpsetrdhiivkeslravdcnteym
Timeline for d6s68b_: