Lineage for d6s68b_ (6s68 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547687Species Aequorea australis [TaxId:1246302] [391430] (2 PDB entries)
  8. 2547689Domain d6s68b_: 6s68 B: [391431]
    automated match to d2hpwa_
    complexed with pia

Details for d6s68b_

PDB Entry: 6s68 (more details), 2.06 Å

PDB Description: structure of the fluorescent protein aausfp2 from aequorea cf. australis at ph 7.6
PDB Compounds: (B:) Aequorea cf. australis fluorescent protein 2 (AausFP2)

SCOPe Domain Sequences for d6s68b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s68b_ d.22.1.0 (B:) automated matches {Aequorea australis [TaxId: 1246302]}
lfkgkipfvvelegdvngevfsvrgngwgdgstgkleikfvcttgevplaweslicsmxa
lvfckypsnindffkstmprgyiqerkisyendgtfdvrqevtyengalynrvkfngsgf
rkdgnvlgkkldltsigtciyimgndegtglkgvfnkafkviggnrqiashvqtqtpigd
glvsipdyhvmhnhiacskdpsetrdhiivkeslravdcnteym

SCOPe Domain Coordinates for d6s68b_:

Click to download the PDB-style file with coordinates for d6s68b_.
(The format of our PDB-style files is described here.)

Timeline for d6s68b_:

  • d6s68b_ is new in SCOPe 2.07-stable
  • d6s68b_ does not appear in SCOPe 2.08