Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
Domain d6rijd1: 6rij D:176-309 [391413] Other proteins in same PDB: d6rija_, d6rijc_ automated match to d1h1pb1 complexed with gol, k4w, na |
PDB Entry: 6rij (more details), 2.2 Å
SCOPe Domain Sequences for d6rijd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rijd1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme hlvlkvltfdlaap
Timeline for d6rijd1:
View in 3D Domains from other chains: (mouse over for more information) d6rija_, d6rijb1, d6rijb2, d6rijc_ |