Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Human t-cell leukemia virus 2 [TaxId:11909] [391218] (3 PDB entries) |
Domain d6qbvc_: 6qbv C: [391226] automated match to d5cz2a_ complexed with mg |
PDB Entry: 6qbv (more details), 2.45 Å
SCOPe Domain Sequences for d6qbvc_:
Sequence, based on SEQRES records: (download)
>d6qbvc_ c.55.3.0 (C:) automated matches {Human t-cell leukemia virus 2 [TaxId: 11909]} rgllpnhiwqgdvthykykkykyclhvwvdtfsgavsvsckkketscetisaflqaisll gkplhintdngpaflsqefqefctsyhikhsthipynptssglvertngiiknllnkyll dcpnlpldnainkalwtlnqlnvmnpsgktrwqihhsp
>d6qbvc_ c.55.3.0 (C:) automated matches {Human t-cell leukemia virus 2 [TaxId: 11909]} rgllpnhiwqgdvthykykkykyclhvwvdtfsgavsvsckkketscetisaflqaisll gkplhintdngpaflsqefqefctsyhikhstglvertngiiknllnkylldcpnlpldn ainkalwtlnqlnvmsgktrwqihhsp
Timeline for d6qbvc_: