SCOPe 2.08: Domain d6qbva_: 6qbv A:

Lineage for d6qbva_ (6qbv A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human t-cell leukemia virus 2 [TaxId:11909] [391218] (3 PDB entries)

8. Domain d6qbva_: 6qbv A: [391222]
   automated match to d5cz2a_
   complexed with mg

Details for d6qbva_

PDB Entry: 6qbv, 2.45 Å

PDB Description: structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form)

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d6qbva_:

Sequence, based on SEQRES records:

>d6qbva_ c.55.3.0 (A:) automated matches {Human t-cell leukemia virus 2 [TaxId: 11909]}
rgllpnhiwqgdvthykykkykyclhvwvdtfsgavsvsckkketscetisaflqaisll
gkplhintdngpaflsqefqefctsyhikhsthipynptssglvertngiiknllnkyll
dcpnlpldnainkalwtlnqlnvmnpsgktrwqihhsp

Sequence, based on observed residues (ATOM records):

>d6qbva_ c.55.3.0 (A:) automated matches {Human t-cell leukemia virus 2 [TaxId: 11909]}
rgllpnhiwqgdvthykykkykyclhvwvdtfsgavsvsckkketscetisaflqaisll
gkplhintdngpaflsqefqefctsyhikhsthvertngiiknllnkylldcpnlpldna
inkalwtlnqlnvmsgktrwqihhsp

Timeline for d6qbva_:

• d6qbva_ first appeared in SCOPe 2.07