Lineage for d6mc1c1 (6mc1 C:320-466)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875775Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2875930Domain d6mc1c1: 6mc1 C:320-466 [391110]
    Other proteins in same PDB: d6mc1c2
    automated match to d1zzwa_
    complexed with act, cja, dtt

Details for d6mc1c1

PDB Entry: 6mc1 (more details), 2.7 Å

PDB Description: structure of map kinase phosphatase 5 in complex with 3,3-dimethyl-1- ((9-(methylthio)-5,6-dihydrothieno[3,4-h]quinazolin-2-yl)thio)butan- 2-one, an allosteric inhibitor
PDB Compounds: (C:) Dual specificity protein phosphatase 10

SCOPe Domain Sequences for d6mc1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mc1c1 c.45.1.0 (C:320-466) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeltpilpflflgneqdaqdldtmqrlnigyvinvtthlplyhyekglfnykrlpatdsn
kqnlrqyfeeafefieeahqcgkgllihcqagvsrsativiaylmkhtrmtmtdaykfvk
gkrpiispnlnfmgqllefeedlnngv

SCOPe Domain Coordinates for d6mc1c1:

Click to download the PDB-style file with coordinates for d6mc1c1.
(The format of our PDB-style files is described here.)

Timeline for d6mc1c1: