SCOPe 2.08: Domain d4lxvg1: 4lxv G:1-322

Lineage for d4lxvg1 (4lxv G:1-322)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza a virus [TaxId:114727] [390987] (1 PDB entry)

8. Domain d4lxvg1: 4lxv G:1-322 [391077]
   Other proteins in same PDB: d4lxva2, d4lxvb_, d4lxvc2, d4lxvd_, d4lxve2, d4lxvf_, d4lxvg2, d4lxvh_, d4lxvi2, d4lxvj_, d4lxvk2, d4lxvl_
   automated match to d3hmga_
   complexed with nag

Details for d4lxvg1

PDB Entry: 4lxv, 3 Å

PDB Description: crystal structure of the hemagglutinin from a h1n1pdm a/washington/5/2011 virus

PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4lxvg1:

Sequence; same for both SEQRES and ATOM records:

>d4lxvg1 b.19.1.0 (G:1-322) automated matches {Influenza a virus [TaxId: 114727]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagakgfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpsttadqqslyqnadtyvfvgtsryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnvp

Timeline for d4lxvg1:

• d4lxvg1 first appeared in SCOPe 2.07