Lineage for d4lxvj_ (4lxv J:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041348Domain d4lxvj_: 4lxv J: [391072]
    Other proteins in same PDB: d4lxva1, d4lxva2, d4lxvc1, d4lxvc2, d4lxve1, d4lxve2, d4lxvg1, d4lxvg2, d4lxvi1, d4lxvi2, d4lxvk1, d4lxvk2
    automated match to d3m5jb_
    complexed with nag

Details for d4lxvj_

PDB Entry: 4lxv (more details), 3 Å

PDB Description: crystal structure of the hemagglutinin from a h1n1pdm a/washington/5/2011 virus
PDB Compounds: (J:) Hemagglutinin

SCOPe Domain Sequences for d4lxvj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lxvj_ h.3.1.1 (J:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidkitnkvnsviekmnt
qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
vrnqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree

SCOPe Domain Coordinates for d4lxvj_:

Click to download the PDB-style file with coordinates for d4lxvj_.
(The format of our PDB-style files is described here.)

Timeline for d4lxvj_: