Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza a virus [TaxId:114727] [390987] (1 PDB entry) |
Domain d4lxva1: 4lxv A:1-322 [391032] Other proteins in same PDB: d4lxva2, d4lxvb_, d4lxvc2, d4lxvd_, d4lxve2, d4lxvf_, d4lxvg2, d4lxvh_, d4lxvi2, d4lxvj_, d4lxvk2, d4lxvl_ automated match to d3hmga_ complexed with nag |
PDB Entry: 4lxv (more details), 3 Å
SCOPe Domain Sequences for d4lxva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lxva1 b.19.1.0 (A:1-322) automated matches {Influenza a virus [TaxId: 114727]} dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt sswpnhdsnkgvtaacphagakgfyknliwlvkkgnsypklsksyindkgkevlvlwgih hpsttadqqslyqnadtyvfvgtsryskkfkpeiairpkvrdqegrmnyywtlvepgdki tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti gkcpkyvkstklrlatglrnvp
Timeline for d4lxva1: