Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d6la6f_: 6la6 F: [390875] Other proteins in same PDB: d6la6a_, d6la6c_, d6la6e1, d6la6e2 automated match to d1xh3b_ |
PDB Entry: 6la6 (more details), 2.39 Å
SCOPe Domain Sequences for d6la6f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6la6f_ b.1.1.2 (F:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d6la6f_:
View in 3D Domains from other chains: (mouse over for more information) d6la6a_, d6la6c_, d6la6e1, d6la6e2 |