![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
![]() | Protein automated matches [190746] (16 species) not a true protein |
![]() | Species Mycoplasma capricolum [TaxId:40479] [390788] (1 PDB entry) |
![]() | Domain d6l2la1: 6l2l A:2-147 [390789] Other proteins in same PDB: d6l2la2 automated match to d2b3jd_ complexed with zn |
PDB Entry: 6l2l (more details), 2.4 Å
SCOPe Domain Sequences for d6l2la1:
Sequence, based on SEQRES records: (download)
>d6l2la1 c.97.1.0 (A:2-147) automated matches {Mycoplasma capricolum [TaxId: 40479]} ddfnnildllineskkaikhndipvscciidsnnnilslainsryknkdisqhaeinvin dlisklnsfnlskyklittlepcmmcysaikqvkintiyylvdsykfgiknnysindqnl nliqiknqkkqseyikllniffinkr
>d6l2la1 c.97.1.0 (A:2-147) automated matches {Mycoplasma capricolum [TaxId: 40479]} ddfnnildllineskkaikhndipvscciidsnnnilslainsryknkdisqhaeinvin dlisklnsfnlskyklittlepcmmcysaikqvkintiyylvdsykfgiknnyqnlnliq iknqkkqseyikllniffinkr
Timeline for d6l2la1: